PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Gh_D08G1600
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Malvales; Malvaceae; Malvoideae; Gossypium
Family MYB
Protein Properties Length: 329aa    MW: 37007.4 Da    PI: 6.5089
Description MYB family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Gh_D08G1600genomeNAU-NBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Myb_DNA-binding48.52e-152572148
                     TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHHT CS
  Myb_DNA-binding  1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqkyl 48
                     +g W++eEde+l ++    G g+W+ Ia+  g+ R++k+c++rw +yl
      Gh_D08G1600 25 KGLWSPEEDEKLMKYMLTNGQGCWSDIAKNAGLQRCGKSCRLRWINYL 72
                     678*******************************************97 PP

2Myb_DNA-binding506.8e-1678122147
                      TSSS-HHHHHHHHHHHHHTTTT-HHHHHHHHTTTS-HHHHHHHHHHH CS
  Myb_DNA-binding   1 rgrWTteEdellvdavkqlGggtWktIartmgkgRtlkqcksrwqky 47 
                      rg+++ +E+el+++++  lG++ W+ Ia++++ gRt++++k++w++ 
      Gh_D08G1600  78 RGAFSLQEEELIIHLHSILGNR-WSQIAARLP-GRTDNEIKNFWNST 122
                      89********************.*********.***********986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.601.2E-231975IPR009057Homeodomain-like
PROSITE profilePS5129417.7882072IPR017930Myb domain
SuperFamilySSF466891.68E-2822119IPR009057Homeodomain-like
SMARTSM007171.3E-112474IPR001005SANT/Myb domain
PfamPF002492.1E-142572IPR001005SANT/Myb domain
CDDcd001671.49E-92872No hitNo description
PROSITE profilePS5129425.12473127IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.8E-2576128IPR009057Homeodomain-like
SMARTSM007171.2E-1577125IPR001005SANT/Myb domain
PfamPF002492.2E-1478122IPR001005SANT/Myb domain
CDDcd001671.33E-1080123No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 329 aa     Download sequence    Send to blast
MRKPDPNMPK TNTNTNTTNK MKLRKGLWSP EEDEKLMKYM LTNGQGCWSD IAKNAGLQRC  60
GKSCRLRWIN YLRPDLKRGA FSLQEEELII HLHSILGNRW SQIAARLPGR TDNEIKNFWN  120
STLKKRLKNN TSTSSSPNNS DSSEPRDVVG GIFPLHEHHA MTFCMDSISS SSTISMPPMG  180
TGNQFDPFPL LNINRYDKTG GAAGLLDLPT CLTQGGLGEA LYGDYGVLEP GKIALEGDFS  240
LPPLESRSIE ESNAAINSID RKSNNNNHHH HHNNNTCFNN TDQSFKVGEA FGLENHHWEA  300
ENLRMGEWEL EGLMDNISSF PNFLDFQVE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1h8a_C4e-272312725128MYB TRANSFORMING PROTEIN
Search in ModeBase
Annotation -- Nucleotide ? help Back to Top
Source Hit ID E-value Description
GenBankJX6144040.0JX614404.1 Gossypium hirsutum clone NBRI_GE57753 microsatellite sequence.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012475461.10.0PREDICTED: transcription factor MYB46
SwissprotQ9LXV23e-69MYB46_ARATH; Transcription factor MYB46
TrEMBLA0A0D2R6G80.0A0A0D2R6G8_G
STRINGPOPTR_0001s27430.11e-146(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM70772642
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G08500.19e-85myb domain protein 83